A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10386
Swiss-prot Accession number	O18641 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (HeA-PBAN); Gamma-SGneuropeptide].
Source organism	Helicoverpa assulta (Oriental tobacco budworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Heliothinae; Helicoverpa.
Subcellular location	Secreted protein
Developmental Stage	Detected in 1-3 day old moths.
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Synthesized in the suboesophageal ganglion and released in the hemolymph
Post translational modification	N/A
Function	N/A
Protein Length	194 Amino acids
Molecular weight	22343
References	1  PubMed abstract 9807222 2   Tang Q., Yang X., An S., Jiu M., Guo X., Ma J.; "cDNA cloning and sequence determination of the diapause hormoneneuropeptide of the oriental to tobacco budworm, Helicoverpaassulta."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Diapause hormone homolog
Mature Hormone Sequence	NDVKDGAASGAHSDRLGLWFGPRL
Position of mature hormone in Pre-Hormone protein	24 Residues from position (24-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10387
Swiss-prot Accession number	O18641 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (HeA-PBAN); Gamma-SGneuropeptide].
Source organism	Helicoverpa assulta (Oriental tobacco budworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Heliothinae; Helicoverpa.
Subcellular location	Secreted protein
Developmental Stage	Detected in 1-3 day old moths.
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Synthesized in the suboesophageal ganglion and released in the hemolymph
Post translational modification	N/A
Function	N/A
Protein Length	194 Amino acids
Molecular weight	22343
References	1  PubMed abstract 9807222 2   Tang Q., Yang X., An S., Jiu M., Guo X., Ma J.; "cDNA cloning and sequence determination of the diapause hormoneneuropeptide of the oriental to tobacco budworm, Helicoverpaassulta."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Alpha-SG neuropeptide
Mature Hormone Sequence	VIFTPKL
Position of mature hormone in Pre-Hormone protein	7 Residues from position (97-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10388
Swiss-prot Accession number	O18641 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (HeA-PBAN); Gamma-SGneuropeptide].
Source organism	Helicoverpa assulta (Oriental tobacco budworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Heliothinae; Helicoverpa.
Subcellular location	Secreted protein
Developmental Stage	Detected in 1-3 day old moths.
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Synthesized in the suboesophageal ganglion and released in the hemolymph
Post translational modification	N/A
Function	N/A
Protein Length	194 Amino acids
Molecular weight	22343
References	1  PubMed abstract 9807222 2   Tang Q., Yang X., An S., Jiu M., Guo X., Ma J.; "cDNA cloning and sequence determination of the diapause hormoneneuropeptide of the oriental to tobacco budworm, Helicoverpaassulta."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Beta-SG neuropeptide
Mature Hormone Sequence	PKLGRSLAYDDKSFENVEFTPRL
Position of mature hormone in Pre-Hormone protein	18 Residues from position (106-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10389
Swiss-prot Accession number	O18641 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (HeA-PBAN); Gamma-SGneuropeptide].
Source organism	Helicoverpa assulta (Oriental tobacco budworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Heliothinae; Helicoverpa.
Subcellular location	Secreted protein
Developmental Stage	Detected in 1-3 day old moths.
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Synthesized in the suboesophageal ganglion and released in the hemolymph
Post translational modification	N/A
Function	PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity)
Protein Length	194 Amino acids
Molecular weight	22343
References	1  PubMed abstract 9807222 2   Tang Q., Yang X., An S., Jiu M., Guo X., Ma J.; "cDNA cloning and sequence determination of the diapause hormoneneuropeptide of the oriental to tobacco budworm, Helicoverpaassulta."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Pheromone biosynthesis-activating neuropeptide
Mature Hormone Sequence	LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL
Position of mature hormone in Pre-Hormone protein	33 Residues from position (127-159)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10390
Swiss-prot Accession number	O18641 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (HeA-PBAN); Gamma-SGneuropeptide].
Source organism	Helicoverpa assulta (Oriental tobacco budworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Heliothinae; Helicoverpa.
Subcellular location	Secreted protein
Developmental Stage	Detected in 1-3 day old moths.
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Synthesized in the suboesophageal ganglion and released in the hemolymph
Post translational modification	N/A
Function	N/A
Protein Length	194 Amino acids
Molecular weight	22343
References	1  PubMed abstract 9807222 2   Tang Q., Yang X., An S., Jiu M., Guo X., Ma J.; "cDNA cloning and sequence determination of the diapause hormoneneuropeptide of the oriental to tobacco budworm, Helicoverpaassulta."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Gamma-SG neuropeptide
Mature Hormone Sequence	TMNFSPRL
Position of mature hormone in Pre-Hormone protein	8 Residues from position (162-169)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated